TA346185 17-beta-HSD1 / HSD17B1 Antikörper

Rabbit Polyclonal Anti-HSD17B1 Antibody

See related secondary antibodies

Search for all "17-beta-HSD1 / HSD17B1"

0.1 ml / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Kurzübersicht

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat 17-beta-HSD1 / HSD17B1

TA346185

Mehr Bilder

  • TA346185

Produktbeschreibung für 17-beta-HSD1 / HSD17B1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat 17-beta-HSD1 / HSD17B1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Produktdaten von 17-beta-HSD1 / HSD17B1

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.1 ml
Synonyme 17-beta-hydroxysteroid dehydrogenase type 1, 17E2DH, 20 alpha-hydroxysteroid dehydrogenase, 20-alpha HSD, E17KSR, EDH17B1, EDH17B2, EDHB17, Estradiol 17-beta-dehydrogenase 1, Placental 17-beta-hydroxysteroid dehydrogenase
Präsentation Purified
Reaktivität Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Anwendungen P, WB
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies, Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
P14061
Immunogen:
The immunogen for anti-HSD17B1 antibody: synthetic peptide directed towards the N terminal of human HSD17B1. Synthetic peptide located within the following region: MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAA.
GeneID:
3292
Anwendung WB
IHC
Background HSD17B1 is favors the reduction of estrogens and androgens. It also has 20-alpha-HSD activity. It uses preferentially NADH.
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteine zu 17-beta-HSD1 / HSD17B1 (4 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

17-beta-HSD1 / HSD17B1 (1-328, His-tag)

17-beta-HSD1 / HSD17B1 Human Purified > 90 % by SDS - PAGE E. coli
0.25 mg / 820,00 €
  OriGene Technologies GmbH

17-beta-HSD1 / HSD17B1 (1-328, His-tag)

17-beta-HSD1 / HSD17B1 Human Purified > 90 % by SDS - PAGE E. coli
50 µg / 320,00 €
  OriGene Technologies GmbH

17-beta-HSD1 / HSD17B1

17-beta-HSD1 / HSD17B1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

17-beta-HSD1 / HSD17B1

17-beta-HSD1 / HSD17B1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn