TA346232 3-beta-HSD1 / HSD3B1 Antikörper

Rabbit Polyclonal Anti-HSD3B1 Antibody

See related secondary antibodies

Search for all "3-beta-HSD1 / HSD3B1"

0.1 ml / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Kurzübersicht

Rabbit anti Bovine, Equine, Goat, Human, Porcine, Rat, Sheep 3-beta-HSD1 / HSD3B1

TA346232

Produktbeschreibung für 3-beta-HSD1 / HSD3B1

Rabbit anti Bovine, Equine, Goat, Human, Porcine, Rat, Sheep 3-beta-HSD1 / HSD3B1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von 3-beta-HSD1 / HSD3B1

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.1 ml
Synonyme 3-beta-hydroxysteroid dehydrogenase, Delta 5-->4-isomerase type 1, Trophoblast Marker
Präsentation Purified
Reaktivität Bov, Eq, Gt, Hu, Por, Rt, Sh
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies, Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
P14060
Immunogen:
The immunogen for anti-HSD3B1 antibody: synthetic peptide directed towards the N terminal of human HSD3B1. Synthetic peptide located within the following region: TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQ.
GeneID:
3283
Anwendung WB
Background 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids.
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteine zu 3-beta-HSD1 / HSD3B1 (3 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

3-beta-HSD1 / HSD3B1

3-beta-HSD1 / HSD3B1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 748,00 €
  OriGene Technologies, Inc.

3-beta-HSD1 / HSD3B1

3-beta-HSD1 / HSD3B1 Human in vitro transl.
  Abnova Taiwan Corp.

3-beta-HSD1 / HSD3B1

3-beta-HSD1 / HSD3B1 Human in vitro transl.
  Abnova Taiwan Corp.

Positive controls for 3-beta-HSD1 / HSD3B1 (3 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

HSD3B1 293T Cell Transient Overexpression Lysate(Denatured)

HSD3B1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

HSD3B1 Lysate

Western Blot: HSD3B1 Lysate [NBL1-11732] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for HSD3B1
  Novus Biologicals Inc.

HSD3B1 overexpression lysate

HSD3B1 overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.
  • LinkedIn