TA334658 3-beta HSD2 / HSD3B2 Antikörper

Rabbit Polyclonal Anti-HSD3B2 Antibody

See related secondary antibodies

Search for all "3-beta HSD2 / HSD3B2"

0.1 ml / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Kurzübersicht

Rabbit anti Bovine, Canine, Equine, Goat, Human, Mouse, Rat, Sheep 3-beta HSD2 / HSD3B2

TA334658

Mehr Bilder

  • TA334658
  • TA334658

Produktbeschreibung für 3-beta HSD2 / HSD3B2

Rabbit anti Bovine, Canine, Equine, Goat, Human, Mouse, Rat, Sheep 3-beta HSD2 / HSD3B2.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Produktdaten von 3-beta HSD2 / HSD3B2

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.1 ml
Synonyme 3-beta-HSD II, 3-beta-hydroxysteroid dehydrogenase, Delta 5-->4-isomerase type 2, HSDB3B
Präsentation Purified
Reaktivität Bov, Can, Eq, Gt, Hu, Ms, Rt, Sh
Anwendungen P, WB
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies, Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
P26439
Immunogen:
The immunogen for anti-HSD3B2 antibody: synthetic peptide directed towards the N terminal of human HSD3B2. Synthetic peptide located within the following region: GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN.
GeneID:
3284
Anwendung IHC
WB
Background 3-beta-HSD is a bifunctiol enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormol steroids.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteine zu 3-beta HSD2 / HSD3B2 (6 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

3-beta HSD2 / HSD3B2

3-beta HSD2 / HSD3B2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 748,00 €
  OriGene Technologies, Inc.

3-beta HSD2 / HSD3B2 (transcript variant 2)

3-beta HSD2 / HSD3B2 Human > 80 %
Preparation: or Add: Recombint proteins was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 748,00 €
  OriGene Technologies, Inc.

3-beta HSD2 / HSD3B2

3-beta HSD2 / HSD3B2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

3-beta HSD2 / HSD3B2

3-beta HSD2 / HSD3B2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

3-beta HSD2 / HSD3B2

3-beta HSD2 / HSD3B2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

3-beta HSD2 / HSD3B2

3-beta HSD2 / HSD3B2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for 3-beta HSD2 / HSD3B2 (1 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

Beta Hydroxysteroid Dehydrogenase Lysate

Western Blot: Beta Hydroxysteroid Dehydrogenase Lysate [NBL1-11733] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for HSD3B2
  Novus Biologicals Inc.
  • LinkedIn