TA339548 3-beta HSD7 / HSD3B7 (Center) Antikörper

Rabbit Polyclonal Anti-HSD3B7 Antibody

See related secondary antibodies

Search for all "3-beta HSD7 / HSD3B7"

0.1 ml / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Kurzübersicht

Rabbit anti Human 3-beta HSD7 / HSD3B7

Produktbeschreibung für 3-beta HSD7 / HSD3B7

Rabbit anti Human 3-beta HSD7 / HSD3B7.
Properties: (Center)
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von 3-beta HSD7 / HSD3B7

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.1 ml
Synonyme 3 beta-hydroxysteroid dehydrogenase type 7, 3 beta-hydroxysteroid dehydrogenase type VII, 3-beta-hydroxy-Delta(5)-C27 steroid oxidoreductase, 7-alpha-diol 3-beta-dehydrogenase, Cholest-5-ene-3-beta
Präsentation Aff - Purified
Reaktivität Hu
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies, Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q9H2F3
Immunogen:
Synthetic peptide directed towards the middle region of human HSD3B7
AA Sequence:
QGTRNVIEACVQTGTRFLVYTSSMEVVGPNTKGHPFYRGNEDTPYEAVHR
GeneID:
80270
Eigenschaften Center
Anwendung

Western blotting  (0.2 -1 µg/ml).

Background This gene encodes an enzyme which is involved in the initial stages of the synthesis of bile acids from cholesterol and a member of the short-chain dehydrogenase/reductase superfamily. The encoded protein is a membrane-associated endoplasmic reticulum protein which is active against 7-alpha hydrosylated sterol substrates. Mutations in this gene are associated with a congenital bile acid synthesis defect which leads to neonatal cholestasis, a form of progressive liver disease. Multiple transcript variants encoding different isoforms have been found for this gene.
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Rabbit, Guinea Pig, Dog, Bovine, Pig
Species reactivity (tested):
Human.

Accessory Products

Proteins and/or Positive Controls

Proteine zu 3-beta HSD7 / HSD3B7 (4 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

3-beta HSD7 / HSD3B7

3-beta HSD7 / HSD3B7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

3-beta HSD7 / HSD3B7

3-beta HSD7 / HSD3B7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

3-beta HSD7 / HSD3B7

3-beta HSD7 / HSD3B7 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

3-beta HSD7 / HSD3B7

3-beta HSD7 / HSD3B7 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for 3-beta HSD7 / HSD3B7 (1 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

HSD3B7 Lysate

Western Blot: HSD3B7 Lysate [NBL1-11734] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for HSD3B7.
  Novus Biologicals Inc.
  • LinkedIn