TA331686 A2LD1 Antikörper

Rabbit Polyclonal Anti-GGACT Antibody

See related secondary antibodies

Search for all "A2LD1"

0.1 ml / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Kurzübersicht

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit A2LD1

Produktbeschreibung für A2LD1

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit A2LD1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von A2LD1

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.1 ml
Synonyme AIG2-like domain-containing protein 1, GGACT, Gamma-glutamylaminecyclotransferase
Präsentation Purified
Reaktivität Bov, Can, Eq, Hu, Por, Rb
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies, Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q9BVM4
Immunogen:
The immunogen for Anti-A2LD1 Antibody is: synthetic peptide directed towards the N-terminal region of Human A2LD1. Synthetic peptide located within the following region: GTLKRGQPNHRVLRDGAHGSAAFRARGRTLEPYPLVIAGEHNIPWLLHLP.
GeneID:
87769
Anwendung WB
Background The protein encoded by this gene aids in the proteolytic degradation of crosslinked fibrin by breaking down isodipeptide L-gamma-glutamyl-L-epsilon-lysine, a byproduct of fibrin degradation. The reaction catalyzed by the encoded gamma-glutamylaminecyclotransferase produces 5-oxo-L-proline and a free alkylamine. Two transcript variants encoding the same protein have been found for this gene.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteine zu A2LD1 (5 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

A2LD1

A2LD1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 748,00 €
  OriGene Technologies, Inc.

A2LD1

A2LD1 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
10 µg / 299,00 €
  OriGene Technologies, Inc.

A2LD1 (1-153, His-tag)

A2LD1 Human Purified > 95 % E. coli
0.25 mg / 1.070,00 €
  OriGene Technologies GmbH

A2LD1 (1-153, His-tag)

A2LD1 Human Purified > 95 % E. coli
50 µg / 400,00 €
  OriGene Technologies GmbH

A2LD1

A2LD1 Human
  Abnova Taiwan Corp.

Positive controls for A2LD1 (1 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

GGACT overexpression lysate

GGACT overexpression lysate
0.1 mg / 315,00 €
  OriGene Technologies, Inc.
  • LinkedIn