73-267 ABCC8 Antikörper

See related secondary antibodies

Search for all "ABCC8"

5 ml / 490,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

NeuroMab

Kurzübersicht

Mouse anti Hamster, Human, Mouse ABCC8 N289/16

73-267

Mehr Bilder

  • 73-267
  • 73-267

Produktbeschreibung für ABCC8

Mouse anti Hamster, Human, Mouse ABCC8 N289/16.
Presentation: Supernatant
Product is tested for Frozen Sections, Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Produktdaten von ABCC8

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 5 ml
Synonyme ATP-binding cassette transporter sub-family C member 8, HRINS, SUR, SUR1, Sulfonylurea receptor 1
Präsentation Supernatant
Reaktivität Hst, Hu, Ms
Anwendungen C, ICC/IF, WB
Klonalität Monoclonal
Klon N289/16
Wirt Mouse
Isotype IgG1
Molecular weight 180 kDa
Shipping to Worldwide
PDF datasheet Datenblatt ansehen
Hersteller Antibodies Incorporated

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q09429
Immunogen:
Fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat SUR1 (also known as Sulfonylurea receptor 1, SUR, HRINS,ATP binding cassette transporter subfamily C member 8 and Abcc8, accession number Q09429).
Mouse: 100% identity (35/35 amino acids identical).
Human: 94% identity (33/35 amino acids identical).
Similar % identity with other isoforms.
>70% identity with SUR2B.
GeneID:
25559
Add. information USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows:
"The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616."
Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity.
Anwendung Immunoblot (IB)
Immunohistochemistry (IHC)
Immunocytochemistry (ICC)
Format
State:
Supernatant
Specificity
Specificity:
Does not cross-react with SUR2B

Accessory Products

  • LinkedIn