TA339635 ABHD13 Antikörper

Rabbit Polyclonal Anti-ABHD13 Antibody

See related secondary antibodies

Search for all "ABHD13"

0.1 ml / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Kurzübersicht

Rabbit anti Bovine, Chicken, Human, Mouse, Rat, African clawed frog ABHD13

Produktbeschreibung für ABHD13

Rabbit anti Bovine, Chicken, Human, Mouse, Rat, African clawed frog ABHD13.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von ABHD13

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.1 ml
Synonyme Abhydrolase domain-containing protein 13, C13orf6
Präsentation Aff - Purified
Reaktivität African clawed frog, Bov, Chk, Hu, Ms, Rt
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies, Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q7L211
Immunogen:
Synthetic peptide directed towards the N terminal of human ABHD13
AA Sequence:
SRLYVPMPTGIPHENIFIRTKDGIRLNLILIRYTGDNSPYSPTIIYFHGN
GeneID:
84945
Anwendung

Western blotting  (0.2 -1 µg/ml).

Background ABHD13 is a single-pass type II membrane protein. It belongs to the serine esterase family. The exact function of ABHD13 remains unknown.
General Readings Dunham,A., (2004) Nature 428 (6982), 522-528
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Rat, Bovine, Mouse, African clawed frog, Chicken
Species reactivity (tested):
Human.
Specificity
Specificity:
Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.

Accessory Products

Proteins and/or Positive Controls

Proteine zu ABHD13 (2 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

ABHD13

ABHD13 Human Purified
  Abnova Taiwan Corp.

ABHD13

ABHD13 Human Purified
  Abnova Taiwan Corp.
  • LinkedIn