nicht mehr verfügbar

H00080325-B01 ABTB1 Antikörper

See related secondary antibodies

Search for all "ABTB1"

Kurzübersicht

Mouse anti Human ABTB1

Produktbeschreibung für ABTB1

Mouse anti Human ABTB1.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Produktdaten von ABTB1

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 50 µl
Synonyme Ankyrin repeat and BTB/POZ domain-containing protein 1, BPOZ, PP2259
Präsentation Serum
Reaktivität Hu
Anwendungen E(detection), WB
Klonalität Polyclonal
Wirt Mouse
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q969K4
Immunogen:
ABTB1 (NP_115937.1, 1 a.a. ~ 336 a.a) full-length human protein.
AA Sequence:
MLDTKWKGKSVVVLRHPLINPVAFGALLQYLYTGRLDIGVEHVSDCERLAKQCQLWDLLSDLEAKCEKVSEFVASK PGTCVKVLTIEPPPADPRLREDMALLADCALPPELRGDLWELPFPCPDGFNSCPDICFRVAGCSFLCHKAFFCGRS DYFRALLDDHFRESEEPATSGGPPAVTLHGISPDVFTHVLYYMYSDHTELSPEAAYDVLSVADMYLLPGLKRLCGR SLAQMLDEDTVVGVWRVAKLFRLARLEDQCTEYMAKVIEKLVEREDFVEAVKEEAAAVAARQETDSIPLVDDIRFH VASTVQTYSAIEEAQQRLRALEDLLVSIGLDC
GeneID:
80325
Remarks:
Gene Accession: NM_032548.2
Add. information Mouse polyclonal antibody raised against a full-length human ABTB1 protein.

Antibody reactive against mammalian transfected lysate.
Anwendung Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 80325

Accessory Products

Proteins and/or Positive Controls

Proteine zu ABTB1 (5 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

ABTB1 (full length, N-term HIS tag, transcript variant 1)

ABTB1 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / 205,00 €
  OriGene Technologies, Inc.

ABTB1

ABTB1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ABTB1

ABTB1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ABTB1

ABTB1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ABTB1

ABTB1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ABTB1 (1 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

ABTB1 293T Cell Transient Overexpression Lysate(Denatured)

ABTB1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn