TA346440 ACOT2 Antikörper

Rabbit Polyclonal Anti-ACOT2 Antibody

See related secondary antibodies

Search for all "ACOT2"

0.1 ml / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Kurzübersicht

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat ACOT2

TA346440

Mehr Bilder

  • TA346440

Produktbeschreibung für ACOT2

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat ACOT2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von ACOT2

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.1 ml
Synonyme Acyl-CoA thioesterase 2, Acyl-coenzyme A thioester hydrolase 2a, Acyl-coenzyme A thioesterase 2, CTE-Ia, Long-chain acyl-CoA thioesterase 2, PTE2, PTE2A, ZAP128
Präsentation Purified
Reaktivität Bov, Can, Eq, Hu, Ms, Rb, Rt
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies, Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
P49753
Immunogen:
The immunogen for anti-ACOT2 antibody: synthetic peptide directed towards the middle region of human ACOT2. Synthetic peptide located within the following region: SPLEGPDQKSFIPVERAESTFLFLVGQDDHNWKSEFYANEACKRLQAHGR.
GeneID:
10965
Anwendung WB
Background Acyl-CoA thioesterases, such as ACOT2, are a group of enzymes that hydrolyze CoA esters, such as acyl-CoAs, bile CoAs, and CoA esters of prostaglandins, to the corresponding free acid and CoA.Acyl-CoA thioesterases, such as ACOT2, are a group of enzymes that hydrolyze CoA esters, such as acyl-CoAs, bile CoAs, and CoA esters of prostaglandins, to the corresponding free acid and CoA (Hunt et al., 2005 [PubMed 16103133]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-7 CR610624.1 1-7 8-1155 BC006335.2 1-1148 1156-1767 L40401.1 468-1079
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn