TA335873 ACSBG2 Antikörper

Rabbit Polyclonal Anti-ACSBG2 Antibody

See related secondary antibodies

Search for all "ACSBG2"

0.1 ml / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Kurzübersicht

Rabbit anti Bovine, Equine, Guinea Pig, Human, Zebrafish ACSBG2

Produktbeschreibung für ACSBG2

Rabbit anti Bovine, Equine, Guinea Pig, Human, Zebrafish ACSBG2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von ACSBG2

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.1 ml
Synonyme Acyl-CoA synthetase bubblegum family member 2, BGR, Long-chain-fatty-acid--CoA ligase ACSBG2, PRTD-NY3
Präsentation Purified
Reaktivität Bov, Eq, GP, Hu, Ze
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies, Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q5FVE4
Immunogen:
The immunogen for Anti-ACSBG2 Antibody: synthetic peptide directed towards the middle region of human ACSBG2. Synthetic peptide located within the following region: LNQETAEFFLSLDIPIGELYGLSESSGPHTISNQNNYRLLSCGKILTGCK.
GeneID:
81616
Anwendung WB
Background ACSBG2 belongs to the ATP-dependent AMP-binding enzyme family, bubblegum subfamily.ACSBG2 mediates activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. It is able to activate long-chain fatty acids. Also able to activate very long-chain fatty acids; however, the relevance of such activity is unclear in vivo. ACSBG2 has increased ability to activate oleic and linoleic acid. It may play a role in spermatogenesis.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteine zu ACSBG2 (2 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

ACSBG2

ACSBG2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ACSBG2

ACSBG2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ACSBG2 (2 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

ACSBG2 293T Cell Transient Overexpression Lysate(Denatured)

ACSBG2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ACSBG2 overexpression lysate

ACSBG2 overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.
  • LinkedIn