AM31714PU-N ACTA2 / aortic smooth muscle Actin Antikörper

See related secondary antibodies

Search for all "ACTA2 / aortic smooth muscle Actin"

50 µg / 475,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Kurzübersicht

Mouse anti Human ACTA2 / aortic smooth muscle Actin 1D11-2B9

AM31714PU-N

Mehr Bilder

  • AM31714PU-N
  • AM31714PU-N
  • AM31714PU-N

Produktbeschreibung für ACTA2 / aortic smooth muscle Actin

Mouse anti Human ACTA2 / aortic smooth muscle Actin 1D11-2B9.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Paraffin Sections, Western blot / Immunoblot.

Produktdaten von ACTA2 / aortic smooth muscle Actin

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 50 µg
Synonyme ACTSA, ACTVS, Alpha-actin-2, Cell growth-inhibiting gene 46 protein
Präsentation Purified
Reaktivität Hu
Anwendungen E, P, WB
Klonalität Monoclonal
Klon 1D11-2B9
Wirt Mouse
Isotype IgG1
Shipping to Worldwide
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies GmbH
Material safety datasheet MSDS for Monoclonal Antibodies (de)

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
P62736
Immunogen:
ACTA2 (AAH17554, 1 a.a. ~ 378 a.a) full-length recombinant protein with GST tag.
AA Sequence:
MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHG IITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTG IVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENE MATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGG TTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF
GeneID:
59
Remarks:
MW of the GST tag alone is 26 KDa.
Isotype control AM03095PU-N, SM10P (for use in human samples)
Anwendung ELISA.
Immunohistochemistry on Paraffin Sections: 5 µg/ml.
Western Blot: 1/500 - 1/1000.
Background Actin alpha 2, the human aortic smooth muscle actin gene, is one of six different actin isoforms which have been identified. Actins are highly conserved proteins that are involved in cell motility, structure and integrity. Alpha actins are a major constituent of the contractile apparatus.
Concentration 0.5 mg/ml
Storage Store the antibody (in aliquots) at -20°C or lower.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Protein A Chromatography
Buffer System:
PBS, pH 7.2
State:
Liquid purified Ig fraction
Purified
Species Reactivity
Species reactivity (tested):
Human.
Specificity
Specificity:
Recognizes aortic smooth muscle Actin / ACTA2.
Gene ID 59

Accessory Products

Proteins and/or Positive Controls

Proteine zu ACTA2 / aortic smooth muscle Actin (6 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

ACTA2 / aortic smooth muscle Actin (transcript variant 1)

ACTA2 / aortic smooth muscle Actin Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 748,00 €
  OriGene Technologies, Inc.

ACTA2 / aortic smooth muscle Actin (3-377, His-tag)

ACTA2 / aortic smooth muscle Actin Human Purified > 85 % by SDS - PAGE E. coli
0.25 mg / 1.070,00 €
  OriGene Technologies GmbH

ACTA2 / aortic smooth muscle Actin (3-377, His-tag)

ACTA2 / aortic smooth muscle Actin Human Purified > 85 % by SDS - PAGE E. coli
50 µg / 400,00 €
  OriGene Technologies GmbH

ACTA2 / aortic smooth muscle Actin

ACTA2 / aortic smooth muscle Actin Human
  Abnova Taiwan Corp.

ACTA2 / aortic smooth muscle Actin

ACTA2 / aortic smooth muscle Actin Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ACTA2 / aortic smooth muscle Actin

ACTA2 / aortic smooth muscle Actin Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ACTA2 / aortic smooth muscle Actin (1 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

Actin Alpha 2 Smooth Muscle Lysate

Western Blot: Actin Alpha 2 Smooth Muscle Lysate [NBL1-07272] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ACTA2 Protein
  Novus Biologicals Inc.
  • LinkedIn