TA345763 ADARB1 / ADAR2 Antikörper

Rabbit Polyclonal Anti-ADARB1 Antibody

See related secondary antibodies

Search for all "ADARB1 / ADAR2"

0.1 ml / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Kurzübersicht

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rat ADARB1 / ADAR2

Produktbeschreibung für ADARB1 / ADAR2

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rat ADARB1 / ADAR2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von ADARB1 / ADAR2

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.1 ml
Synonyme DRADA2, Double-stranded RNA-specific editase 1, RED1, RNA-editing deaminase 1, RNA-editing enzyme 1, dsRNA adenosine deaminase
Präsentation Purified
Reaktivität Bov, Can, Eq, Hu, Ms, Rt
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies, Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
P78563
Immunogen:
The immunogen for anti-ADARB1 antibody: synthetic peptide directed towards the N terminal of human ADARB1. Synthetic peptide located within the following region: NMSSSSTDVKENRNLDNVSPKDGSTPGPGEGSQLSNGGGGGPGRKRPLEE.
GeneID:
104
Anwendung WB
Background ADARB1 is an enzyme responsible for pre-mR editing of the glutamate receptor subunit B by site-specific deamition of adenosines. Studies in rat found that this enzyme acted on its own pre-mR molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site. This gene encodes the enzyme responsible for pre-mR editing of the glutamate receptor subunit B by site-specific deamition of adenosines. Studies in rat found that this enzyme acted on its own pre-mR molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site. Altertive splicing of this gene results in several transcript variants, some of which have been characterized by the presence or absence of an ALU cassette insert and a short or long C-termil region.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteine zu ADARB1 / ADAR2 (6 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

ADARB1 / ADAR2 (transcript variant 1)

ADARB1 / ADAR2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 748,00 €
  OriGene Technologies, Inc.

ADARB1 / ADAR2 (transcript variant 2)

ADARB1 / ADAR2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 748,00 €
  OriGene Technologies, Inc.

ADARB1 / ADAR2

ADARB1 / ADAR2 Human Purified
  Abnova Taiwan Corp.

ADARB1 / ADAR2

ADARB1 / ADAR2 Human Purified
  Abnova Taiwan Corp.

ADARB1 / ADAR2

ADARB1 / ADAR2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ADARB1 / ADAR2

ADARB1 / ADAR2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ADARB1 / ADAR2 (5 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

ADARB1 293T Cell Transient Overexpression Lysate(Denatured)

ADARB1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ADARB1 293T Cell Transient Overexpression Lysate(Denatured)

ADARB1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ADARB1 overexpression lysate

ADARB1 overexpression lysate
0.1 mg / 495,00 €
  OriGene Technologies, Inc.

ADARB1 overexpression lysate

ADARB1 overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.

ADARB1 overexpression lysate

ADARB1 overexpression lysate
0.1 mg / 495,00 €
  OriGene Technologies, Inc.
  • LinkedIn