TA337973 AIG1 Antikörper

Rabbit Polyclonal Anti-Aig1 Antibody

See related secondary antibodies

Search for all "AIG1"

0.1 ml / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Kurzübersicht

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit, Rat AIG1

Produktbeschreibung für AIG1

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit, Rat AIG1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von AIG1

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.1 ml
Synonyme Androgen-induced protein 1, CGI-103
Präsentation Purified
Reaktivität Bov, Can, GP, Hu, Ms, Rb, Rt
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies, Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q9D8B1
Immunogen:
The immunogen for anti-Aig1 antibody is: synthetic peptide directed towards the middle region of Mouse Aig1. Synthetic peptide located within the following region: AVFFGICVLTDLSSLLTRGSGNQEQERQLRKLISLRDWTLAVLAFPVGVF.
GeneID:
66253
Anwendung WB
Background Aig1 may play a role in androgen-regulated growth of hair follicles.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn