TA344349 ALDH2 Antikörper

Rabbit Polyclonal Anti-ALDH2 Antibody - C-terminal region

See related secondary antibodies

Search for all "ALDH2"

0.1 ml / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Kurzübersicht

Rabbit anti Human, Mouse ALDH2

Produktbeschreibung für ALDH2

Rabbit anti Human, Mouse ALDH2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von ALDH2

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.1 ml
Synonyme ALDH class 2, ALDH-E2, ALDHI, ALDM, Aldehyde dehydrogenase mitochondrial
Präsentation Purified
Reaktivität Hu, Ms
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies, Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
P05091
Immunogen:
The immunogen for Anti-Aldh2 antibody is synthetic peptide directed towards the C-terminal region of Mouse Aldh2. Synthetic peptide located within the following region: QPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANDSKYGLAAAV.
GeneID:
217
Anwendung WB
Background Aldh2 is capable of converting retildehyde to retinoic acid.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteine zu ALDH2 (12 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

ALDH2

ALDH2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 748,00 €
  OriGene Technologies, Inc.

ALDH2 (18-517)

Recombinant human ALDH2, 18-517 aa: 15% SDS-PAGE (3 µg) Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / 600,00 €
  OriGene Technologies GmbH

ALDH2 (18-517)

Recombinant human ALDH2, 18-517 aa: 15% SDS-PAGE (3 µg) Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / 250,00 €
  OriGene Technologies GmbH

ALDH2

ALDH2 Human Purified
  Abnova Taiwan Corp.

ALDH2

ALDH2 Human
  Abnova Taiwan Corp.

ALDH2

ALDH2 Human Purified
  Abnova Taiwan Corp.

ALDH2

ALDH2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ALDH2

ALDH2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ALDH2

ALDH2 Human
  Abnova Taiwan Corp.

ALDH2

ALDH2 Human
  Abnova Taiwan Corp.

ALDH2

ALDH2 Human
  Abnova Taiwan Corp.

ALDH2

Western Blot: ALDH2 Protein [NBC1-19053] - Molecular Weight: 54.5 kDa (501aa) on 15% SDS-PAGE (3ug) Protein
  Novus Biologicals Inc.

Positive controls for ALDH2 (2 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

ALDH2 Lysate

Western Blot: ALDH2 Lysate [NBL1-07454] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ALDH2 Protein
  Novus Biologicals Inc.

ALDH2 overexpression lysate

ALDH2 overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.
  • LinkedIn