TA344350 ALDH5 Antikörper

Rabbit Polyclonal Anti-ALDH1B1 Antibody - middle region

See related secondary antibodies

Search for all "ALDH5"

0.1 ml / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Kurzübersicht

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat ALDH5

TA344350

Mehr Bilder

  • TA344350

Produktbeschreibung für ALDH5

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat ALDH5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von ALDH5

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.1 ml
Synonyme ALDH1B1, ALDHX, Aldehyde dehydrogenase 5, Aldehyde dehydrogenase X, Aldehyde dehydrogenase family 1 member B1
Präsentation Purified
Reaktivität Bov, Can, Eq, Hu, Ms, Por, Rt
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies, Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
P30837
Immunogen:
The immunogen for anti-ALDH1B1 antibody: synthetic peptide directed towards the middle region of human ALDH1B1. Synthetic peptide located within the following region: GFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGL.
GeneID:
219
Anwendung WB
Background ALDH1B1 belongs to the aldehyde dehydrogeses family of proteins. Aldehyde dehydrogese is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.This protein belongs to the aldehyde dehydrogeses family of proteins. Aldehyde dehydrogese is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteine zu ALDH5 (3 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

ALDH5

ALDH5 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 748,00 €
  OriGene Technologies, Inc.

ALDH5

ALDH5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ALDH5

ALDH5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ALDH5 (1 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

ALDH1B1 overexpression lysate

ALDH1B1 overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.
  • LinkedIn