AP43589PU-N ALG2 Antikörper

See related secondary antibodies

Search for all "ALG2"

0.1 ml / 430,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Kurzübersicht

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat, African clawed frog ALG2

Produktbeschreibung für ALG2

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat, African clawed frog ALG2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von ALG2

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.1 ml
Synonyme 3-mannosyltransferase ALG2, Alpha-1, Asparagine-linked glycosylation protein 2, GDP-Man:Man(1)GlcNAc(2)-PP-dolichol mannosyltransferase
Präsentation Aff - Purified
Reaktivität African clawed frog, Bov, Can, Hu, Ms, Por, Rt
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Shipping to Worldwide
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q9H553
Immunogen:
Synthetic peptide directed towards the C terminal of human ALG2
AA Sequence:
QSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQC
GeneID:
85365
Anwendung Western blotting (0.2 - 1.0 µg/ml)
Background ALG2 is a member of the glycosyltransferase 1 family. It acts as an alpha 1,3 mannosyltransferase, mannosylating Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. Defects in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ii).This gene encodes a member of the glycosyltransferase 1 family. The encoded protein acts as an alpha 1,3 mannosyltransferase, mannosylating Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. Defects in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ii).
General Readings "A new type of congenital disorders of glycosylation (CDG-Ii) provides new insights into the early steps of dolichol-linked oligosaccharide biosynthesis." Thiel C., Schwarz M., Peng J., Grzmil M., Hasilik M., Braulke T., Kohlschuetter A., von Figura K., Lehle L., Koerner C. J. Biol. Chem. 278:22498-22505(2003)
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Bovine, Pig, Dog, African clawed frog, Zebrafish
Species reactivity (tested):
Human
Gene ID 85365

Accessory Products

Proteins and/or Positive Controls

Proteine zu ALG2 (5 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

ALG2 (transcript variant 1)

ALG2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 748,00 €
  OriGene Technologies, Inc.

ALG2

ALG2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ALG2

ALG2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ALG2

ALG2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ALG2

ALG2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ALG2 (2 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

ALG2 293T Cell Transient Overexpression Lysate(Denatured)

ALG2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ALG2 Lysate

Western Blot: ALG2 Lysate [NBL1-07467] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ALG2 Protein
  Novus Biologicals Inc.
  • LinkedIn