TA343270 ALOX5 / LOG5 Antikörper

Rabbit Polyclonal Anti-ALOX5 Antibody

See related secondary antibodies

Search for all "ALOX5 / LOG5"

0.1 ml / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Kurzübersicht

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ALOX5 / LOG5

Produktbeschreibung für ALOX5 / LOG5

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ALOX5 / LOG5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von ALOX5 / LOG5

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.1 ml
Synonyme 5-LO, 5-lipoxygenase, Arachidonate 5-lipoxygenase
Präsentation Purified
Reaktivität Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies, Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
P09917
Immunogen:
The immunogen for anti-ALOX5 antibody is: synthetic peptide directed towards the C-terminal region of Human ALOX5. Synthetic peptide located within the following region: FGQLFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPYYY.
GeneID:
240
Anwendung WB
Background This gene encodes a member of the lipoxygese gene family and plays a dual role in the synthesis of leukotrienes from arachidonic acid. The encoded protein, which is expressed specifically in bone marrow-derived cells, catalyzes the conversion of arachidonic acid to 5(S)-hydroperoxy-6-trans-8,11,14-cis-eicosatetraenoic acid, and further to the allylic epoxide 5(S)-trans-7,9-trans-11,14-cis-eicosatetrenoic acid (leukotriene A4). Leukotrienes are important mediators of a number of inflammatory and allergic conditions. Mutations in the promoter region of this gene lead to a diminished response to antileukotriene drugs used in the treatment of asthma and may also be associated with atherosclerosis and several cancers. Altertively spliced transcript variants encoding different isoforms have been found for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 1030% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteine zu ALOX5 / LOG5 (3 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

ALOX5 / LOG5

ALOX5 / LOG5 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 748,00 €
  OriGene Technologies, Inc.

ALOX5 / LOG5

ALOX5 / LOG5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ALOX5 / LOG5

ALOX5 / LOG5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ALOX5 / LOG5 (3 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

5 Lipoxygenase Lysate

Western Blot: 5 Lipoxygenase Lysate [NBL1-07483] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ALOX5 Protein
  Novus Biologicals Inc.

ALOX5 / LOG5 Lysate(Denatured)

ALOX5 / LOG5 Lysate(Denatured)
  Abnova Taiwan Corp.

ALOX5 overexpression lysate

ALOX5 overexpression lysate
0.1 mg / 495,00 €
  OriGene Technologies, Inc.
  • LinkedIn