nicht mehr verfügbar

H00008853-A01 ASAP2 / DDEF2 Antikörper

See related secondary antibodies

Search for all "ASAP2 / DDEF2"

Kurzübersicht

Mouse anti Human ASAP2 / DDEF2

Produktbeschreibung für ASAP2 / DDEF2

Mouse anti Human ASAP2 / DDEF2.
Presentation: Serum
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Produktdaten von ASAP2 / DDEF2

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 50 µl
Synonyme Arf-GAP with SH3 domain ANK repeat and PH domain-containing protein 2, Development and differentiation-enhancing factor 2, KIAA0400, PAG3, PAP, Paxillin-associated protein with ARF GAP activity 3, Pyk2 C-terminus-associated protein
Präsentation Serum
Reaktivität Hu
Anwendungen E, WB
Klonalität Polyclonal
Wirt Mouse
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
O43150
Immunogen:
DDEF2 (NP_003878, 909 a.a. ~ 1007 a.a) partial recombinant protein with GST tag.
AA Sequence:
RGPVDLSATEALGPLSNAMVLQPPAPMPRKSQATKLKPKRVKALYNCVADNPDELTFSEGDVIIVDGEEDQEWWIG HIDGDPGRKGAFPVSFVHFIAD*
GeneID:
8853
Remarks:
Gene Accession: NM_003887
Add. information Mouse polyclonal antibody raised against a partial recombinant DDEF2.

Antibody Reactive Against Recombinant Protein.
Anwendung ELISA,WB-Ce,WB-Re
Storage 50 % glycerol
Format
Label:
None
Purification:
Serum
Buffer System:
50 % glycerol
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 8853

Accessory Products

Proteins and/or Positive Controls

Proteine zu ASAP2 / DDEF2 (4 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

ASAP2 / DDEF2

ASAP2 / DDEF2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ASAP2 / DDEF2

ASAP2 / DDEF2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ASAP2 / DDEF2

ASAP2 / DDEF2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ASAP2 / DDEF2

ASAP2 / DDEF2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ASAP2 / DDEF2 (3 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

ASAP2 overexpression lysate

ASAP2 overexpression lysate
0.1 mg / 495,00 €
  OriGene Technologies, Inc.

DDEF2 293T Cell Transient Overexpression Lysate(Denatured)

DDEF2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PAG3 / ASAP2 Lysate

Western Blot: PAG3 Lysate [NBL1-09768] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for ASAP2.
  Novus Biologicals Inc.
  • LinkedIn