nicht mehr verfügbar

H00139105-B01P BEND2 Antikörper

See related secondary antibodies

Search for all "BEND2"

Kurzübersicht

Mouse anti Human BEND2

Produktbeschreibung für BEND2

Mouse anti Human BEND2.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Produktdaten von BEND2

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 50 µg
Synonyme BEN domain-containing protein 2, CXorf20
Präsentation Purified
Reaktivität Hu
Anwendungen E(detection), WB
Klonalität Polyclonal
Wirt Mouse
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q8NDZ0
Immunogen:
CXorf20 (NP_699177.1, 1 a.a. ~ 799 a.a) full-length human protein.
AA Sequence:
MSERTQEQDFVIITVDDSDDNNDCSIEMVEVSETADNSTNDIADDSTYVTADNPTDDTATQPNFPGGNDGHHRPLQ MSYGSGSVTQAGVQWHDHSSLQPQPLGLKQFFHLSLPSSWDDRRTPPCPVAHGDQIVSQINHPVHLRRYSYNSEEV DFPKRGRFYTPEVQSSISPPAERQETHAWASPAVTSLESAACHELQEADLSESLSYPRIVSSSSLQQYVAQGGSFP CFGMPWNFISGGAESTNAVISFANATTAVPMAVLSRRESSLANNPGVVNYSALPENENVGPGRALSSFCFHPNLEM PERPANSSKNSTETANYPTLMGNYNGQNTASLSVFIPPYFAEKIILTEMPGTTETNVENNSQTVYYPALSGNTSAP YPASSYLPITSNFESGPQMSYGTMSYSTEMKNNCDQDDASASACLTPDFALLPLNILVKVDTNTENSVNTMNRSTL LDSDSGQDSSSSSVCIPPKYGYLGDPKRNVRVLKIHLLAVQNMAKPKQAACYLVRILFSKEILISSSVDIHLKDSQ SLDPNKMAALREYLATTFPTCDLHEHGKDWQDCISGINSMIYCLCSEGKSTPKTVRKNKKRTNRVASASADRNDQR GRDGGEGCSWMFQPMNNSKMRVKRNLQPNSNAIPEGMREPSTDNPEEPGEAWSYFGRPWRNIRMPCSVLTLAKTKS CASLSARYLIQKLFTKDVLVQSNVYGNLKHGLCALDPNKISALREFLQENYPICDLSENGRDWKSCVTSINSGIRS LRHDVRRAEARSQSLPAVTPPELEQESKPGDPDATDPST
GeneID:
139105
Remarks:
Gene Accession: NM_153346.2
Add. information Mouse polyclonal antibody raised against a full-length human CXorf20 protein.

Antibody reactive against mammalian transfected lysate.
Anwendung Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 139105

Accessory Products

Proteins and/or Positive Controls

Positive controls for BEND2 (2 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

CXorf20 293T Cell Transient Overexpression Lysate(Denatured)

CXorf20 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CXorf20 Lysate

Western Blot: CXorf20 Lysate [NBL1-09637] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for BEND2
  Novus Biologicals Inc.
  • LinkedIn