nicht mehr verfügbar

TA334107 BNC1 Antikörper

Rabbit Polyclonal Anti-Bnc1 Antibody

See related secondary antibodies

Search for all "BNC1"

Kurzübersicht

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat BNC1

TA334107

Produktbeschreibung für BNC1

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat BNC1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von BNC1

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 50 µg
Synonyme Zinc finger protein basonuclin-1
Präsentation Purified
Reaktivität Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies, Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
O35914
Immunogen:
The immunogen for Anti-Bnc1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ETSEDHFRAAYLLQDVAKEAYQDVAFTPQASQTSVIFKGTSGMGSLVYPI.
GeneID:
12173
Anwendung WB
Background The function of Bnc1 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn