nicht mehr verfügbar

H00051236-B01P Brain protein 16 Antikörper

See related secondary antibodies

Search for all "Brain protein 16"

Kurzübersicht

Mouse anti Human Brain protein 16

H00051236-B01P

Mehr Bilder

  • H00051236-B01P

Produktbeschreibung für Brain protein 16

Mouse anti Human Brain protein 16.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Produktdaten von Brain protein 16

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 50 µg
Synonyme BRP16, C8orf30A, chromosome 8 open reading frame 30A
Präsentation Purified
Reaktivität Hu
Anwendungen E(detection), WB
Klonalität Polyclonal
Wirt Mouse
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q9BTY7
Immunogen:
C8orf30A (NP_057542.2, 1 a.a. ~ 390 a.a) full-length human protein.
AA Sequence:
MGEAGAGAGASGGPEASPEAEVVKLLPFLAPGARADLQAAAVRHVLALTGCGPGRALLAGQAALLQALMELAPASA PARDAARALVNLAADPGLHETLLAADPGLPARLMGRALDPQWPWAEEAAAALANLSREPAPCAALMAALAAAEPAD SGLERLVRALCTPGYNARAPLHYLAPLLSNLSQRPAARAFLLDPDRCVVQRLLPLTQYPDSSVRRGGVVGTLRNCC FEHRHHEWLLGPEVDILPFLLLPLAGPEDFSEEEMERLPVDLQYLPPDKQREPDADIRKMLVEAIMLLTATAPGRQ QVRDQGAYLILRELHSWEPEPDVRTACEKLIQVLIGDEPERGMENLLEVQVPEDVEQQLQQLDCREQEQLERELAP EPWVERATPT
GeneID:
51236
Remarks:
Gene Accession: NM_016458
Add. information Mouse polyclonal antibody raised against a full-length human C8orf30A protein.

Antibody reactive against mammalian transfected lysate.
Anwendung Det Ab,WB-Ti,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 51236

Accessory Products

Proteins and/or Positive Controls

Proteine zu Brain protein 16 (2 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

Brain protein 16

Brain protein 16 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Brain protein 16

Brain protein 16 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Brain protein 16 (1 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

C8orf30A 293T Cell Transient Overexpression Lysate(Denatured)

C8orf30A 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn