nicht mehr verfügbar

NBP1-90475 C10orf128 Antikörper

See related secondary antibodies

Search for all "C10orf128"


Rabbit anti Human C10orf128

Produktbeschreibung für C10orf128

Rabbit anti Human C10orf128.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Produktdaten von C10orf128

Produkt-Kategorie Primärantikörper
Menge 0.1 ml
Präsentation Aff - Purified
Reaktivität Hu
Anwendungen P
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Novus Biologicals Inc.


Swiss Prot Num:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: RKLQASTLFSFKSLLQCHHCIMEGLFKAKPQFLQKVSCKSDHL
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
Aff - Purified
Gene ID 170371

Accessory Products

  • LinkedIn