nicht mehr verfügbar

H00284029-B01P C17orf44 Antikörper

See related secondary antibodies

Search for all "C17orf44"

Kurzübersicht

Mouse anti Human C17orf44

H00284029-B01P

Produktbeschreibung für C17orf44

Mouse anti Human C17orf44.
Product is tested for Western blot / Immunoblot.

Produktdaten von C17orf44

Produkt-Kategorie Primärantikörper
Menge 0.5 mg
Synonyme FLJ34790, MGC104931
Reaktivität Hu
Anwendungen WB
Klonalität Polyclonal
Wirt Mouse
Shipping to Worldwide
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q8NAT9
Immunogen:
C17orf44 (AAH89396.1, 1 a.a. ~ 148 a.a) full-length human protein.
AA Sequence:
MILASGARGPGFKSRTSPPLPFTETRVSSRNMLPDQRCRRLDCKSSMYSKLFCGTAVAESISIPRPAWHVRKRRGT PRLGQVPPFLLPDFLPGVSTRPPQPGFALIDTRQSIVVDDSVRESPGTVKTWFSAVLKALCLFRSLHLTIGA
GeneID:
284029
Add. information Mouse polyclonal antibody raised against a full-length human C17orf44 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn