nicht mehr verfügbar

NBP1-90936 C7orf59 Antikörper

See related secondary antibodies

Search for all "C7orf59"

Kurzübersicht

Rabbit anti Human C7orf59

NBP1-90936

Mehr Bilder

  • NBP1-90936

Produktbeschreibung für C7orf59

Rabbit anti Human C7orf59.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Produktdaten von C7orf59

Produkt-Kategorie Primärantikörper
Menge 0.1 ml
Präsentation Aff - Purified
Reaktivität Hu
Anwendungen P, WB
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Novus Biologicals Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q0VGL1
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV
GeneID:
389541
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 389541

Accessory Products

Proteins and/or Positive Controls

Proteine zu C7orf59 (3 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

Chromosome 7 open reading frame 59 (C7orf59)

Chromosome 7 open reading frame 59 (C7orf59) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 438,00 €
  OriGene Technologies, Inc.

LAMTOR4 (1-99, His-tag)

LAMTOR4 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / 730,00 €
  Acris Antibodies GmbH

LAMTOR4 (1-99, His-tag)

LAMTOR4 Human Purified > 85 % by SDS - PAGE E. coli
20 µg / 300,00 €
  Acris Antibodies GmbH

Positive controls for C7orf59 (1 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

LAMTOR4 overexpression lysate

LAMTOR4 overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.
  • LinkedIn