nicht mehr verfügbar

NBP1-93736 C9orf171 Antikörper

See related secondary antibodies

Search for all "C9orf171"

Kurzübersicht

Rabbit anti Human C9orf171

Produktbeschreibung für C9orf171

Rabbit anti Human C9orf171.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Produktdaten von C9orf171

Produkt-Kategorie Primärantikörper
Menge 0.1 ml
Präsentation Aff - Purified
Reaktivität Hu
Anwendungen P
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Novus Biologicals Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q6ZQR2
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: SSAVQKVIPSLAGHHIKGGPQAELGKPRERSYSLPGINFNYGLYIRGLDGGVPEAIGRWNVFKQQPTCPHELTRNYIAMN
GeneID:
389799
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 389799

Accessory Products

Proteins and/or Positive Controls

Positive controls for C9orf171 (1 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

C9orf171 overexpression lysate

C9orf171 overexpression lysate
0.1 mg / 280,00 €
  OriGene Technologies, Inc.
  • LinkedIn