TA338367 CACNB3 Antikörper

Rabbit Polyclonal Anti-CACNB3 Antibody

See related secondary antibodies

Search for all "CACNB3"

0.1 mg / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Kurzübersicht

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat CACNB3

Produktbeschreibung für CACNB3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat CACNB3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von CACNB3

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.1 mg
Synonyme CAB3, CACNLB3, Calcium channel voltage-dependent subunit beta 3, Voltage-dependent L-type calcium channel subunit beta-3
Präsentation Purified
Reaktivität Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies, Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
P54284
Immunogen:
The immunogen for anti-CACNB3 antibody: synthetic peptide directed towards the C terminal of human CACNB3. Synthetic peptide located within the following region: EHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYADAYQDLYQPH.
GeneID:
784
Anwendung WB
Background This gene encodes a regulatory beta subunit of the voltage-dependent calcium channel. Beta subunits are composed of five domains, which contribute to the regulation of surface expression and gating of calcium channels and may also play a role in the regulation of transcription factors and calcium transport. [provided by RefSeq, Oct 2011].
Format
Purification:
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteine zu CACNB3 (3 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

CACNB3

CACNB3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 438,00 €
  OriGene Technologies, Inc.

CACNB3

CACNB3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CACNB3

CACNB3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for CACNB3 (1 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

CACNB3 293T Cell Transient Overexpression Lysate(Denatured)

CACNB3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn