nicht mehr verfügbar

H00006352-B02 CCL5 Antikörper

See related secondary antibodies

Search for all "CCL5"

Kurzübersicht

Mouse anti Human CCL5

H00006352-B02

Produktbeschreibung für CCL5

Mouse anti Human CCL5.
Product is tested for Western blot / Immunoblot.

Produktdaten von CCL5

Produkt-Kategorie Primärantikörper
Menge 50 µl
Synonyme D17S136E, MGC17164, RANTES, SCYA5, SISd, TCP228
Reaktivität Hu
Anwendungen WB
Klonalität Polyclonal
Wirt Mouse
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
D0EI67
Immunogen:
CCL5 (AAH08600, 1 a.a. ~ 91 a.a) full-length human protein.
AA Sequence:
MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANP EKKWVREYINSLEMS
GeneID:
6352
Add. information Mouse polyclonal antibody raised against a full-length human CCL5 protein.
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
No additive.
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn