nicht mehr verfügbar

H00009973-A01 CCS / SOD4 Antikörper

See related secondary antibodies

Search for all "CCS / SOD4"

Kurzübersicht

Mouse anti Human CCS / SOD4

Produktbeschreibung für CCS / SOD4

Mouse anti Human CCS / SOD4.
Presentation: Serum
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Produktdaten von CCS / SOD4

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 50 µl
Synonyme SOD-4, Superoxide Dismutase Copper Chaperone
Präsentation Serum
Reaktivität Hu
Anwendungen E, WB
Klonalität Polyclonal
Wirt Mouse
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
O14618
Immunogen:
CCS (NP_005116, 175 a.a. ~ 275 a.a) partial recombinant protein with GST tag.
AA Sequence:
ADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLT IWEERGRPIAGKGRKESAQPPAHL*
GeneID:
9973
Remarks:
Gene Accession: NM_005125
Add. information Mouse polyclonal antibody raised against a partial recombinant CCS.

Antibody Reactive Against Recombinant Protein.
Anwendung ELISA,WB-Re,WB-Ti
Storage 50 % glycerol
Format
Label:
None
Purification:
Serum
Buffer System:
50 % glycerol
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 9973

Accessory Products

Proteins and/or Positive Controls

Proteine zu CCS / SOD4 (8 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

CCS / SOD4 (1-274, His-tag)

CCS / SOD4 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / 820,00 €
  OriGene Technologies GmbH

CCS / SOD4 (1-274, His-tag)

CCS / SOD4 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / 320,00 €
  OriGene Technologies GmbH

CCS / SOD4

CCS / SOD4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CCS / SOD4

CCS / SOD4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CCS / SOD4

CCS / SOD4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CCS / SOD4

CCS / SOD4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CCS / SOD4

CCS / SOD4 Human Purified
  Novus Biologicals Inc.

CCS / SOD4

CCS / SOD4 Human Purified
  Novus Biologicals Inc.

Positive controls for CCS / SOD4 (2 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

CCS 293T Cell Transient Overexpression Lysate(Denatured)

CCS 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CCS overexpression lysate

CCS overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.
  • LinkedIn