nicht mehr verfügbar

H00000962-B01P CD48 Antikörper

See related secondary antibodies

Search for all "CD48"

Kurzübersicht

Mouse anti Human CD48

H00000962-B01P

Mehr Bilder

  • H00000962-B01P

Produktbeschreibung für CD48

Mouse anti Human CD48.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Produktdaten von CD48

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 50 µg
Synonyme B-lymphocyte activation marker BLAST-1, BCM1, BCM1 surface antigen, BLAST1, Leukocyte antigen MEM-102, MEM-102, TCT.1
Präsentation Purified
Reaktivität Hu
Anwendungen E(detection), WB
Klonalität Polyclonal
Wirt Mouse
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
P09326
Immunogen:
CD48 (NP_001769.2, 1 a.a. ~ 243 a.a) full-length human protein.
AA Sequence:
MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKY FESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKL SCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSFGVEWIAS WLVVTVPTILGLLLT
GeneID:
962
Remarks:
Gene Accession: NM_001778
Add. information Mouse polyclonal antibody raised against a full-length human CD48 protein.

Antibody reactive against mammalian transfected lysate.
Anwendung Det Ab,WB-Ti,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 962

Accessory Products

Proteins and/or Positive Controls

Proteine zu CD48 (6 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

CD48

CD48 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
10 µg / 299,00 €
  OriGene Technologies, Inc.

CD48

CD48 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CD48

CD48 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CD48

CD48 Human Purified
  Abnova Taiwan Corp.

CD48

CD48 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CD48

CD48 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for CD48 (3 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

CD48 293T Cell Transient Overexpression Lysate(Denatured)

CD48 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CD48 Lysate

Western Blot: CD48 Lysate [NBL1-08955] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CD48
  Novus Biologicals Inc.

CD48 overexpression lysate

CD48 overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.
  • LinkedIn