BM6024P CD49c / CD49f (B Isoform specific) Antikörper

See related secondary antibodies

Search for all "CD49c / CD49f"

0.1 mg / 340,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Kurzübersicht

Mouse anti Human CD49c / CD49f PB36

Produktbeschreibung für CD49c / CD49f

Mouse anti Human CD49c / CD49f PB36.
Properties: (B Isoform specific)
Presentation: Purified
Product is tested for Frozen Sections, Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Produktdaten von CD49c / CD49f

Produkt-Kategorie Primärantikörper
Menge 0.1 mg
Synonyme Integrin alpha 3B / Integrin alpha 6B
Präsentation Purified
Reaktivität Hu
Anwendungen C, ICC/IF, WB
Klonalität Monoclonal
Klon PB36
Wirt Mouse
Isotype IgG1
Shipping to Worldwide
PDF datasheet Datenblatt ansehen
Hersteller Acris Antibodies GmbH
Material safety datasheet MSDS for Monoclonal Antibodies (de)

Datenblatt-Auszug

Immunogen
Immunogen:
PB36 is a mouse monoclonal IgG1, k antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin α3B including an appending N-terminal cysteine coupled to keyhole limpet hemocyanin.
AA Sequence:
CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK
Eigenschaften B Isoform specific
Isotype control AM03095PU-N, SM10P (for use in human samples)
Anwendung Suitable for Immunoblotting, Immunocytochemistry, Immunohistochemistry on frozen tissues.
Recommended Dilutions: 1/50-1/100 for Immunohistochemistry with avidin-biotinylated horseradish peroxidase complex (ABC) as detection reagent, and 1/100-1/500 for Immunoblotting applications.
Background Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated a and b subunits. More than 18 a and 8 b subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migration and apoptosis.
For integrin subunits a3 and a6, two cytoplasmic variants, A and B, have been identified.
Concentration 1.0 mg/ml
General Readings
  1. de Melker AA, Sterk LM, Delwel GO, Fles DL, Daams H, Weening JJ, et al. The A and B variants of the alpha 3 integrin subunit: tissue distribution and functional characterization. Lab Invest. 1997 Apr;76(4):547-63. PubMed PMID: 9111516.
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C for longer.
Avoid repeated freeze-thaw cycles.
Shelf life: One year from despatch.
Format
Buffer System:
PBS with 0.09% Sodium Azide as preservative.
State:
Liquid purified IgG fraction.
Purified
Species Reactivity
Species reactivity (expected):
A broad species reactivity is expected because of the conserved nature of the epitope.
Species reactivity (tested):
Human.
Specificity
Specificity:
This antibody recognizes the cytoplasmic domain of integrin subunits α3B and α6B.
PB36 reacts with the basement membrane zone and endothelial cells in skin, tubuli in kidney and all vascular and capillary endothelia in brain and heart.
A broad species reactivity is expected because of the conserved nature of the epitope.

Accessory Products

  • LinkedIn