nicht mehr verfügbar

H00001271-A01 CNTFR Antikörper

See related secondary antibodies

Search for all "CNTFR"

Kurzübersicht

Mouse anti Human CNTFR

H00001271-A01

Mehr Bilder

  • H00001271-A01

Produktbeschreibung für CNTFR

Mouse anti Human CNTFR.
Presentation: Serum
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Produktdaten von CNTFR

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 50 µl
Synonyme CNTFR, CNTFR alpha, Ciliary neurotrophic factor receptor alpha
Präsentation Serum
Reaktivität Hu
Anwendungen E, WB
Klonalität Polyclonal
Wirt Mouse
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
P26992
Immunogen:
CNTFR (NP_671693, 47 a.a. ~ 159 a.a) partial recombinant protein with GST tag.
AA Sequence:
GTANWDAAVTWRVNGTDLAPDLLNGSQLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYP KGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDP*
GeneID:
1271
Remarks:
Gene Accession: NM_147164
Add. information Mouse polyclonal antibody raised against a partial recombinant CNTFR.

Antibody Reactive Against Recombinant Protein.
Anwendung ELISA,WB-Ce,WB-Re
Storage 50 % glycerol
Format
Label:
None
Purification:
Serum
Buffer System:
50 % glycerol
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 1271

Accessory Products

Proteins and/or Positive Controls

Proteine zu CNTFR (5 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

CNTFR (transcript variant 1)

CNTFR Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 680,00 €
  OriGene Technologies, Inc.

CNTFR (23-342, His-tag)

CNTFR Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / 730,00 €
  OriGene Technologies GmbH

CNTFR (23-342, His-tag)

CNTFR Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / 300,00 €
  OriGene Technologies GmbH

CNTFR

CNTFR Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CNTFR

CNTFR Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for CNTFR (2 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

CNTFR overexpression lysate

CNTFR overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.

CNTFR overexpression lysate

CNTFR overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.
  • LinkedIn