TA342812 CNTFR Antikörper

Rabbit Polyclonal Anti-CNTFR Antibody

See related secondary antibodies

Search for all "CNTFR"

0.1 ml / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.


Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep CNTFR


Produktbeschreibung für CNTFR

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep CNTFR.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von CNTFR

Produkt-Kategorie Primärantikörper
Menge 0.1 ml
Synonyme CNTFR, CNTFR alpha, Ciliary neurotrophic factor receptor alpha
Präsentation Purified
Reaktivität Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Sh
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies, Inc.


Swiss Prot Num:
The immunogen for anti-CNTFR antibody: synthetic peptide directed towards the C terminal of human CNTFR. Synthetic peptide located within the following region: VAAHATPWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGG.
Anwendung WB
Background This gene encodes a hematopoeitin/interferon-class receptor belonging to the cytokine superfamily of receptors. The encoded gene product represents the CNTF-specific alpha subunit of a heterotrimer forming the CNTF receptor complex, which also includes LIFR and gp130. The receptor is attached to the membrane by a glycosyl-phosphatidylinositol linkage and contains an immunoglobulin-like C2-type domain and a fibronectin type-III domain. Sigl transduction requires that CNTF bind first to this alpha component, which permits the recruitment of gp130 and LIFR beta to form the tripartite receptor complex. Sigl transduction stimulates gene expression, cell survival or differentiation in a variety of neurol cell types. Altertive splicing has been observed at this locus and two variants, both encoding the same protein, have been identified.
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 570% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteine zu CNTFR (5 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

CNTFR (transcript variant 1)

CNTFR Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 748,00 €
  OriGene Technologies, Inc.

CNTFR (23-342, His-tag)

CNTFR Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / 820,00 €
  OriGene Technologies GmbH

CNTFR (23-342, His-tag)

CNTFR Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / 320,00 €
  OriGene Technologies GmbH


CNTFR Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


CNTFR Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for CNTFR (2 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

CNTFR overexpression lysate

CNTFR overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.

CNTFR overexpression lysate

CNTFR overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.
  • LinkedIn