nicht mehr verfügbar

H00001690-B01P Cochlin Antikörper

See related secondary antibodies

Search for all "Cochlin"

Kurzübersicht

Mouse anti Human Cochlin

H00001690-B01P

Mehr Bilder

  • H00001690-B01P

Produktbeschreibung für Cochlin

Mouse anti Human Cochlin.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Produktdaten von Cochlin

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 50 µg
Synonyme COCH, COCH-5B2, COCH5B2
Präsentation Purified
Reaktivität Hu
Anwendungen E(detection), WB
Klonalität Polyclonal
Wirt Mouse
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
O43405
Immunogen:
COCH (AAH07230.1, 1 a.a. ~ 494 a.a) full-length human protein.
AA Sequence:
MSAAWIPALGLGVCLLLLPGPAGSEGAAPIAITCFTRGLDIRKEKADVLCPGGCPLEEFSVYGNIVYASVSSICGA AVHRGVISNSGGPVRVYSLPGRENYSSVDANGIQSQMLSRWSASFTVTKGKSSTQEATGQAVSTAHPPTGKRLKKT PEKKTGNKDCKADIAFLIDGSFNIGQRRFNLQKNFVGKVALMLGIGTEGPHVGLVQASEHPKIEFYLKNFTSAKDV LFAIKEVGFRGGNSNTGKALKHTAQKFFTVDAGVRKGIPKVVVVFIDGWPSDDIEEAGIVAREFGVNVFIVSVAKP IPEELGMVQDVTFVDKAVCRNNGFFSYHMPNWFGTTKYVKPLVQKLCTHEQMMCSKTCYNSVNIAFLIDGSSSVGD SNFRLMLEFVSNIAKTFEISDIGAKIAAVQFTYDQRTEFSFTDYSTKENVLAVIRNIRYMSGGTATGDAISFTVRN VFGPIRESPNKNFLVIVTDGQSYDDVQGPAAAAHDAAK
GeneID:
1690
Remarks:
Gene Accession: BC007230
Add. information Mouse polyclonal antibody raised against a full-length human COCH protein.

Antibody reactive against mammalian transfected lysate.
Anwendung Det Ab,WB-Ce,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 1690

Accessory Products

Proteins and/or Positive Controls

Proteine zu Cochlin (3 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

Cochlin

Cochlin Human
  Abnova Taiwan Corp.

Cochlin

Cochlin Human Purified
  Abnova Taiwan Corp.

Cochlin

Cochlin Human Purified
  Abnova Taiwan Corp.

Positive controls for Cochlin (1 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

COCH 293T Cell Transient Overexpression Lysate(Denatured)

COCH 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn