TA342870 Complement factor D Antikörper

Rabbit Polyclonal Anti-CFD Antibody

See related secondary antibodies

Search for all "Complement factor D"

50 µg / 325,00 €
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Kurzübersicht

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rat Complement factor D

Produktbeschreibung für Complement factor D

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rat Complement factor D.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von Complement factor D

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 50 µg
Synonyme Adipsin, C3 convertase activator, CFD, DF, PFD, Properdin factor D
Präsentation Purified
Reaktivität Bov, Can, GP, Hu, Ms, Por, Rt
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies, Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
P00746
Immunogen:
The immunogen for anti-CFD antibody: synthetic peptide directed towards the C terminal of human CFD. Synthetic peptide located within the following region: GRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSCKGDSG.
GeneID:
1675
Anwendung WB
Background CFD is a member of the trypsin family of peptidases. The protein is a component of the altertive complement pathway best known for its role in humoral suppression of infectious agents. This protein is also a serine protease that is secreted by adipocytes into the bloodstream. Filly, this protein has a high level of expression in fat, suggesting a role for adipose tissue in immune system biology.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 628% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteine zu Complement factor D (12 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

Complement factor D

Complement factor D Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 680,00 €
  OriGene Technologies, Inc.

Complement factor D (26-253, His-tag)

Complement factor D Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / 730,00 €
  Acris Antibodies GmbH

Complement factor D (26-253, His-tag)

Complement factor D Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / 300,00 €
  Acris Antibodies GmbH

Complement factor D (21-253, His-tag)

Complement factor D Human Purified > 95 % by SDS - PAGE.
0.25 mg / 940,00 €
  Acris Antibodies GmbH

Complement factor D (21-253, His-tag)

Complement factor D Human Purified > 95 % by SDS - PAGE.
50 µg / 300,00 €
  Acris Antibodies GmbH

Complement factor D

Complement factor D Human
  Abnova Taiwan Corp.

Complement factor D

Complement factor D Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Complement factor D

Complement factor D Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Complement factor D

Complement factor D Human
  Abnova Taiwan Corp.

Complement factor D

Complement factor D Human
  Abnova Taiwan Corp.

Complement factor D (WB+ control)

Complement factor D Purified
  Alpha Diagnostic Intl. Inc.

Complement factor D

Complement factor D Human
  Alpha Diagnostic Intl. Inc.
  • LinkedIn