nicht mehr verfügbar

H00064798-D01P DEPDC6 / DEPTOR Antikörper

See related secondary antibodies

Search for all "DEPDC6 / DEPTOR"

Kurzübersicht

Rabbit anti Human DEPDC6 / DEPTOR

H00064798-D01P

Mehr Bilder

  • H00064798-D01P

Produktbeschreibung für DEPDC6 / DEPTOR

Rabbit anti Human DEPDC6 / DEPTOR.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Produktdaten von DEPDC6 / DEPTOR

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.1 mg
Synonyme DEP domain-containing mTOR-interacting protein, DEP domain-containing protein 6
Präsentation Purified
Reaktivität Hu
Anwendungen E(detection), WB
Klonalität Polyclonal
Wirt Rabbit
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q8TB45
Immunogen:
DEPDC6 (AAH12040.1, 1 a.a. ~ 409 a.a) full-length human protein.
AA Sequence:
MEEGGSTGSAGSDSSTSGSGGAQQRELERMAEVLVTGEQLRLRLHEEKVIKDRRHHLKTYPNCFVAKELIDWLIEH KEASDRETAIKLMQKLADRGIIHHVCDEHKEFKDVKLFYRFRKDDGTFPLDNEVKAFMRGQRLYEKLMSPENTLLQ PREEEGVKYERTFMASEFLDWLVQEGEATTRKEAEQLCHRLMEHGIIQHVSSKHPFVDSNLLYQFRMNFRRRRRLM ELLNEKSPSSQETHDSPFCLRKQSHDNRKSTSFMSVSPSKEIKIVSAVRRSSMSSCGSSGYFSSSPTLSSSPPVLC NPKSVLKRPVTSEELLTPGAPYARKTFTIVGDAVGWGFVVRGSKPCHIQAVDPSGPAAAAGMKVCQFVVSVNGLNV LHVDYRTVNNLILTGPRTIVMEVMEELEC
GeneID:
64798
Remarks:
Gene Accession: BC012040
Add. information Rabbit polyclonal antibody raised against a full-length human DEPDC6 protein.

Antibody reactive against mammalian transfected lysate.
Anwendung Det Ab,WB-Ti,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human,Mouse
Gene ID 64798

Accessory Products

Proteins and/or Positive Controls

Proteine zu DEPDC6 / DEPTOR (3 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

DEPDC6 / DEPTOR

DEPDC6 / DEPTOR Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 680,00 €
  OriGene Technologies, Inc.

DEPDC6 / DEPTOR

DEPDC6 / DEPTOR Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DEPDC6 / DEPTOR

DEPDC6 / DEPTOR Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for DEPDC6 / DEPTOR (3 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

DEPDC6 293T Cell Transient Overexpression Lysate(Denatured)

DEPDC6 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

DEPDC6 Lysate

Western Blot: DEPDC6 Lysate [NBL1-09835] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DEPDC6
  Novus Biologicals Inc.

DEPTOR overexpression lysate

DEPTOR overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.
  • LinkedIn