nicht mehr verfügbar

H00051635-B01P DHRS7A Antikörper

See related secondary antibodies

Search for all "DHRS7A"

Kurzübersicht

Mouse anti Human DHRS7A

H00051635-B01P

Mehr Bilder

  • H00051635-B01P
  • H00051635-B01P

Produktbeschreibung für DHRS7A

Mouse anti Human DHRS7A.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Produktdaten von DHRS7A

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 50 µg
Synonyme CGI-86, DHRS7, Dehydrogenase/reductase SDR family member 7, RETSDR4, Retinal short-chain dehydrogenase/reductase 4
Präsentation Purified
Reaktivität Hu
Anwendungen E(detection), WB
Klonalität Polyclonal
Wirt Mouse
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q9Y394
Immunogen:
DHRS7 (NP_057113.1, 1 a.a. ~ 339 a.a) full-length human protein.
AA Sequence:
MNWELLLWLLVLCALLLLLVQLLRFLRADGDLTLLWAEWQGRRPEWELTDMVVWVTGASSGIGEELAYQLSKLGVS LVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGGMSQRSLCMDTSL DVYRKLIELNYLGTVSLTKCVLPHMIERKQGKIVTVNSILGIISVPLSIGYCASKHALRGFFNGLRTELATYPGII VSNICPGPVQSNIVENSLAGEVTKTIGNNGDQSHKMTTSRCVRLMLISMANDLKEVWISEQPFLLVTYLWQYMPTW AWWITNKMGKKRIENFKSGVDADSSYFKIFKTKHD
GeneID:
51635
Remarks:
Gene Accession: NM_016029.1
Add. information Mouse polyclonal antibody raised against a full-length human DHRS7 protein.

Antibody reactive against mammalian transfected lysate.
Anwendung Det Ab,WB-Ce,WB-Ti,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 51635

Accessory Products

Proteins and/or Positive Controls

Proteine zu DHRS7A (2 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

DHRS7A

DHRS7A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DHRS7A

DHRS7A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for DHRS7A (2 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

DHRS7 293T Cell Transient Overexpression Lysate(Denatured)

DHRS7 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

DHRS7 overexpression lysate

DHRS7 overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.
  • LinkedIn