TA341594 DHX30 Antikörper

Rabbit Polyclonal Anti-DHX30 Antibody

See related secondary antibodies

Search for all "DHX30"

50 µg / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Kurzübersicht

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DHX30

Produktbeschreibung für DHX30

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DHX30.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von DHX30

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 50 µg
Synonyme DDX30, DEAH box protein 30, KIAA0890, Putative ATP-dependent RNA helicase DHX30
Präsentation Purified
Reaktivität Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies, Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q7L2E3
Immunogen:
The immunogen for anti-DHX30 antibody: synthetic peptide directed towards the N terminal of human DHX30. Synthetic peptide located within the following region: AASRDLLKEFPQPKNLLNSVIGRALGISHAKDKLVYVHTNGPKKKKVTLH.
GeneID:
22907
Anwendung WB
Background DEAD box proteins, characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative R helicases.They are implicated in a number of cellular processes involving alteration of R secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based onTheir distribution patterns, some members ofThis DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.The family member encoded byThis gene is a mitochondrial nucleoid protein that associates with mitochondrial D. It has also been identified as a component of a transcriptiol repressor complex that functions in retil development, and it is required to optimizeThe function ofThe zinc-finger antiviral protein. Altertively spliced transcript variants have been found forThis gene. [provided by RefSeq, Feb 2013].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteine zu DHX30 (1 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

DHX30 (transcript variant 2)

DHX30 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 680,00 €
  OriGene Technologies, Inc.

Positive controls for DHX30 (4 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

DHX30 293T Cell Transient Overexpression Lysate(Denatured)

DHX30 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

DHX30 Lysate

Western Blot: DHX30 Lysate [NBL1-09879] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DHX30
  Novus Biologicals Inc.

DHX30 Lysate

Western Blot: DHX30 Lysate [NBL1-09880] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DHX30
  Novus Biologicals Inc.

DHX30 overexpression lysate

DHX30 overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.
  • LinkedIn