nicht mehr verfügbar

NBP1-80999 EGR4 Antikörper

See related secondary antibodies

Search for all "EGR4"

Kurzübersicht

Rabbit anti Human EGR4

NBP1-80999

Mehr Bilder

  • NBP1-80999

Produktbeschreibung für EGR4

Rabbit anti Human EGR4.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Produktdaten von EGR4

Produkt-Kategorie Primärantikörper
Menge 0.1 ml
Präsentation Aff - Purified
Reaktivität Hu
Anwendungen P, WB
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Novus Biologicals Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q9UDE5
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PWELLSVGAPGNCGSQGDYQAAPEARFPVIGTKIEDLLSISCPAELPAVPANRLYPSGAYDAFPLAPGDLGEGAEGLPGLLTPPSGEGGSSGDGGEFLASTQPQLSPLGLRSAAAADFPKPL
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified

Accessory Products

  • LinkedIn