nicht mehr verfügbar

NBP1-84702 FDCSP / C4orf7 Antikörper

See related secondary antibodies

Search for all "FDCSP / C4orf7"

Kurzübersicht

Rabbit anti Human FDCSP / C4orf7

Produktbeschreibung für FDCSP / C4orf7

Rabbit anti Human FDCSP / C4orf7.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Produktdaten von FDCSP / C4orf7

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.1 ml
Synonyme FDC secreted protein, FDC-SP, Follicular dendritic cell secreted peptide
Präsentation Aff - Purified
Reaktivität Hu
Anwendungen P
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Novus Biologicals Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q8NFU4
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: KRSISDSDELASGFFVFPYPYPFRPLPPIPFPRFPWFRRNFPIPIPESAPTTPL
GeneID:
260436
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 260436

Accessory Products

Proteins and/or Positive Controls

Proteine zu FDCSP / C4orf7 (2 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

FDCSP / C4orf7 (18-85, His-tag)

FDCSP / C4orf7 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / 730,00 €
  OriGene Technologies GmbH

FDCSP / C4orf7 (18-85, His-tag)

FDCSP / C4orf7 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / 300,00 €
  OriGene Technologies GmbH

Positive controls for FDCSP / C4orf7 (1 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

C4orf7 Lysate

Western Blot: C4orf7 Lysate [NBL1-08481] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C4orf7 Protein
  Novus Biologicals Inc.
  • LinkedIn