nicht mehr verfügbar

NBP1-57033 Glycerol kinase Antikörper

See related secondary antibodies

Search for all "Glycerol kinase"

Kurzübersicht

Rabbit anti Human Glycerol kinase

NBP1-57033

Produktbeschreibung für Glycerol kinase

Rabbit anti Human Glycerol kinase.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von Glycerol kinase

Produkt-Kategorie Primärantikörper
Menge 50 µg
Synonyme GK1, GKD
Präsentation Aff - Purified
Reaktivität Hu
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Shipping to Europe only
PDF datasheet Datenblatt ansehen
Hersteller Novus Biologicals Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
A6NJP5
Immunogen:
Synthetic peptides corresponding to GK (glycerol kinase) The peptide sequence was selected from the middle region of GK. Peptide sequence MAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKS.
GeneID:
2710
Background The product of this gene belongs to the FGGY kinase family of proteins and encodes glycerol kinase. Glycerol kinase is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Defects in this gene are the cause of glycerol kinase deficiency (GKD). Alternatively spliced transcript variants encoding different isoforms have been identified.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 2710

Accessory Products

  • LinkedIn