nicht mehr verfügbar

NBP1-84360 GPAT2 Antikörper

See related secondary antibodies

Search for all "GPAT2"

Kurzübersicht

Rabbit anti Human GPAT2

Produktbeschreibung für GPAT2

Rabbit anti Human GPAT2.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Produktdaten von GPAT2

Produkt-Kategorie Primärantikörper
Menge 0.1 ml
Präsentation Aff - Purified
Reaktivität Hu
Anwendungen P
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Novus Biologicals Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q6NUI2
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: HQKGVFLSQLLGEFSWLTEEILLRGFDVGFSGQLRSLLQHSLSLLRAHVALLRIRQGDLLVVPQPGPGLTHLA
GeneID:
150763
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 150763

Accessory Products

Proteins and/or Positive Controls

Positive controls for GPAT2 (2 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

GPAT2 Lysate

Western Blot: GPAT2 Lysate [NBL1-12580] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for GPAT2
  Novus Biologicals Inc.

GPAT2 overexpression lysate

GPAT2 overexpression lysate
0.1 mg / 280,00 €
  OriGene Technologies, Inc.
  • LinkedIn