TA330121 GTF2H2 / BTF2P44 Antikörper

Rabbit Polyclonal Anti-GTF2H2 Antibody

See related secondary antibodies

Search for all "GTF2H2 / BTF2P44"

0.1 ml / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Kurzübersicht

Rabbit anti Human GTF2H2 / BTF2P44

Produktbeschreibung für GTF2H2 / BTF2P44

Rabbit anti Human GTF2H2 / BTF2P44.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von GTF2H2 / BTF2P44

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.1 ml
Synonyme BTF2-p44, Basic transcription factor 2 44 kDa subunit, General transcription factor IIH polypeptide 2, General transcription factor IIH subunit 2, TFIIH, TFIIH basal transcription factor complex p44 subunit
Präsentation Purified
Reaktivität Hu
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies, Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q13888
Immunogen:
The immunogen for anti-GTF2H2 antibody: synthetic peptide directed towards the middle region of human GTF2H2. Synthetic peptide located within the following region: HHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCD.
GeneID:
2966
Anwendung WB
Background This gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. This gene is within the telomeric copy of the duplication. Deletion of this gene sometimes accompanies deletion of the neighboring SMN1 gene in spil muscular atrophy (SMA) patients but it is unclear if deletion of this gene contributes to the SMA phenotype. This gene encodes the 44 kDa subunit of R polymerase II transcription initiation factor IIH which is involved in basal transcription and nucleotide excision repair. Transcript variants for this gene have been described, but their full length ture has not been determined. A second copy of this gene within the centromeric copy of the duplication has been described in the literature. It is reported to be different by either two or four base pairs; however, no sequence data is currently available for the centromeric copy of the gene. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteine zu GTF2H2 / BTF2P44 (2 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

GTF2H2 / BTF2P44

GTF2H2 / BTF2P44 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

GTF2H2 / BTF2P44

GTF2H2 / BTF2P44 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for GTF2H2 / BTF2P44 (1 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

GTF2H2 293T Cell Transient Overexpression Lysate(Denatured)

GTF2H2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn