nicht mehr verfügbar

H00023462-B02 HEY1 Antikörper

See related secondary antibodies

Search for all "HEY1"

Kurzübersicht

Mouse anti Human HEY1

Produktbeschreibung für HEY1

Mouse anti Human HEY1.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Produktdaten von HEY1

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 50 µl
Synonyme BHLHB31, CHF2, Cardiovascular helix-loop-helix factor 2, Class B basic helix-loop-helix protein 31, HERP2, HES-related repressor protein 1, HESR1, HRT1, Hairy and enhancer of split-related protein 1, Hairy-related transcription factor 1, Hairy/enhancer-of-split related with YRPW motif protein 1
Präsentation Serum
Reaktivität Hu
Anwendungen E(detection), WB
Klonalität Polyclonal
Wirt Mouse
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q9Y5J3
Immunogen:
HEY1 (NP_036390.3, 1 a.a. ~ 304 a.a) full-length human protein.
AA Sequence:
MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLSELRRLV PSAFEKQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAMDYRSLGFRECLAEVARYLSIIEGLDASDPLRV RLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPA LRAPPSGSLGPVLPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQAANLGKPYRPWGTEIGAF
GeneID:
23462
Remarks:
Gene Accession: NM_012258.3
Add. information Mouse polyclonal antibody raised against a full-length human HEY1 protein.

Antibody reactive against mammalian transfected lysate.
Anwendung Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 23462

Accessory Products

Proteins and/or Positive Controls

Proteine zu HEY1 (7 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

HEY1 (transcript variant 2)

HEY1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 680,00 €
  OriGene Technologies, Inc.

HEY1

HEY1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HEY1

HEY1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HEY1

HEY1 Human 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

HEY1

HEY1 Human 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

HEY1

HEY1 Human Purified 95 % E. coli
  GenWay Biotech Inc.

HEY1

HEY1 Human Purified 95 % E. coli
  GenWay Biotech Inc.

Positive controls for HEY1 (4 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

HEY1 Lysate

Western Blot: HEY1 Lysate [NBL1-11520] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for HEY1
  Novus Biologicals Inc.

HEY1 Lysate

Western Blot: HEY1 Lysate [NBL1-11521] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for HEY1
  Novus Biologicals Inc.

HEY1 overexpression lysate

HEY1 overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.

HEY1 overexpression lysate

HEY1 overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.
  • LinkedIn