TA343468 HOXB7 / HOX2C Antikörper

Rabbit Polyclonal Anti-HOXB7 Antibody

See related secondary antibodies

Search for all "HOXB7 / HOX2C"

0.1 ml / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Kurzübersicht

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish HOXB7 / HOX2C

Produktbeschreibung für HOXB7 / HOX2C

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish HOXB7 / HOX2C.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von HOXB7 / HOX2C

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.1 ml
Synonyme HHO.C1, Homeobox protein Hox-B7, Hox-2C
Präsentation Purified
Reaktivität Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies, Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
P09629
Immunogen:
The immunogen for anti-HOXB7 antibody: synthetic peptide directed towards the C terminal of human HOXB7. Synthetic peptide located within the following region: RYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRA.
GeneID:
3217
Anwendung WB
Background HOXB7 is a member of the Antp homeobox family and is a protein with a homeobox D-binding domain. The nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma.This gene is a member of the Antp homeobox family and encodes a protein with a homeobox D-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteine zu HOXB7 / HOX2C (3 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

HOXB7 / HOX2C

HOXB7 / HOX2C Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 748,00 €
  OriGene Technologies, Inc.

HOXB7 / HOX2C

HOXB7 / HOX2C Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HOXB7 / HOX2C

HOXB7 / HOX2C Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for HOXB7 / HOX2C (3 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

HOXB7 HEK293 Cell Transient Overexpression Lysate (Non-Denatured)

HOXB7 HEK293 Cell Transient Overexpression Lysate (Non-Denatured) Transient overexpression cell lysate was tested with Anti-HOXB7 antibody (H00003217-M01) by Western Blots.
  Abnova Taiwan Corp.

HOXB7 HEK293 Cell Transient Overexpression Lysate (Non-Denatured)

HOXB7 HEK293 Cell Transient Overexpression Lysate (Non-Denatured) Transient overexpression cell lysate was tested with Anti-HOXB7 antibody (H00003217-M02) by Western Blots.
  Abnova Taiwan Corp.

HOXB7 overexpression lysate

HOXB7 overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.
  • LinkedIn