nicht mehr verfügbar

H00003514-B01 IGKC Antikörper

See related secondary antibodies

Search for all "IGKC"

Kurzübersicht

Mouse anti Human IGKC

H00003514-B01

Mehr Bilder

  • H00003514-B01

Produktbeschreibung für IGKC

Mouse anti Human IGKC.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot, Paraffin Sections.

Produktdaten von IGKC

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 50 µl
Synonyme Ig kappa chain C region
Präsentation Serum
Reaktivität Hu
Anwendungen E(detection), P, WB
Klonalität Polyclonal
Wirt Mouse
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
P01834
Immunogen:
IGKC (AAH66343.1, 1 a.a. ~ 234 a.a) full-length human protein.
AA Sequence:
MEAPAQLLFLLLLWLPDTTGEIVLTQSPVFLSLSPGEGATLSCRASQSVSRNLAWYQQKSGQAPRLLIYDASNRAT GIPARFSGSGSGTDFTLTISSLEPEDSAVYYCQQRSNCLITFGQGTRLEIRRTVAAPSVFIFPPSDEQLKSGTASV VCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKS FNRGEC
Remarks:
Gene Accession: BC066343.1
Add. information Mouse polyclonal antibody raised against a full-length human IGKC protein.

Antibody reactive against mammalian transfected lysate.
Anwendung Det Ab,IHC-P,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human

Accessory Products

Proteins and/or Positive Controls

Proteine zu IGKC (2 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

IGKC

IGKC Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

IGKC

IGKC Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for IGKC (1 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

IGKC 293T Cell Transient Overexpression Lysate(Denatured)

IGKC 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn