nicht mehr verfügbar

H00284900-B01P KIAA1648 Antikörper

See related secondary antibodies

Search for all "KIAA1648"

Kurzübersicht

Mouse anti Human KIAA1648

H00284900-B01P

Produktbeschreibung für KIAA1648

Mouse anti Human KIAA1648.
Product is tested for Western blot / Immunoblot.

Produktdaten von KIAA1648

Produkt-Kategorie Primärantikörper
Menge 0.5 mg
Synonyme dJ353E16.2
Reaktivität Hu
Anwendungen WB
Klonalität Polyclonal
Wirt Mouse
Shipping to Worldwide
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Immunogen:
KIAA1648 (CAK54441.1, 1 a.a. ~ 240 a.a) full-length human protein.
AA Sequence:
MTMAVVASVCRNDLPSSREGAAPVGRRCLPSQMETAGKWHLFPPGVEMLVSGTPCHFSGHPPAPSWEIQHPHECGA QGHQLFHLLSARPVAPALHPQLTQQGLECAAALLEPVARVGGWEEDSRWQATGWGVQPEAHSGEEGLPARDAAHFV LHTLLGRVHGIALPILDALQGFLHLRGNWGKHWDAGAQASQTGGSVYSHQPGGNKPAWEDRRSALAVPQERGASKA HCPLGQGVSRRS
GeneID:
284900
Add. information Mouse polyclonal antibody raised against a full-length human KIAA1648 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn