nicht mehr verfügbar

NBP1-81316 LEAP2 Antikörper

See related secondary antibodies

Search for all "LEAP2"

Kurzübersicht

Rabbit anti Human LEAP2

Produktbeschreibung für LEAP2

Rabbit anti Human LEAP2.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Produktdaten von LEAP2

Produkt-Kategorie Primärantikörper
Menge 0.1 ml
Präsentation Aff - Purified
Reaktivität Hu
Anwendungen P
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Novus Biologicals Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q969E1
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PIPEVSSAKRRPRRMTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE
GeneID:
116842
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 116842

Accessory Products

Proteins and/or Positive Controls

Proteine zu LEAP2 (2 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

LEAP2

LEAP2 Human
  Abnova Taiwan Corp.

Liver expressed antimicrobial peptide 2 (LEAP2), full length, with N-terminal HIS tag, expressed in E. coli, 50ug (full length, N-term HIS tag)

Liver expressed antimicrobial peptide 2 (LEAP2), full length, with N-terminal HIS tag, expressed in E. coli, 50ug Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / 199,00 €
  OriGene Technologies, Inc.

Positive controls for LEAP2 (2 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

LEAP2 Lysate

Western Blot: LEAP2 Lysate [NBL1-12481] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for LEAP2.
  Novus Biologicals Inc.

LEAP2 overexpression lysate

LEAP2 overexpression lysate
  OriGene Technologies, Inc.
  • LinkedIn