nicht mehr verfügbar

H00391749-B01P LOC391749 Antikörper

See related secondary antibodies

Search for all "LOC391749"

Kurzübersicht

Mouse anti Human LOC391749

Produktbeschreibung für LOC391749

Mouse anti Human LOC391749.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Produktdaten von LOC391749

Produkt-Kategorie Primärantikörper
Menge 50 µg
Synonyme -, TAFII, TAFII-28, TAFII28, TFIID subunit p30-beta, Transcription initiation factor TFIID 28 kDa subunit, similar to Transcription initiation factor TFIID subunit 11
Präsentation Purified
Reaktivität Hu
Anwendungen E(detection), WB
Klonalität Polyclonal
Wirt Mouse
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Immunogen:
LOC391749 (XP_373061.2, 1 a.a. ~ 198 a.a) full-length human protein.
AA Sequence:
METGRQTGVSAEMLAMPRGLKGSKKDGIPEDLDGNLEAPRDQEGELRSEDVMDLTEGDSEASASAPPAAKRRKTHT KGKKESKPTVDAEEAHRMTTLLSAMSEEQLSRYEVCRRSAFPRARVAGLMRAITGSSVSENAAIAMAGIAKLFVGE VVEEALDVCEMWGETHPLQPKHLREAVRRLKPKGLFPNSNCRRIMF
Remarks:
Gene Accession: XM_373061.2
Add. information Mouse polyclonal antibody raised against a full-length human LOC391749 protein.

Antibody reactive against mammalian transfected lysate.
Anwendung Det Ab,WB-Tr
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Purity:
Antibody reactive against mammalian transfected lysate.
State:
Purified
Specificity
Species:
Human

Accessory Products

  • LinkedIn