nicht mehr verfügbar

H00440332-A01 LOC440332 Antikörper

See related secondary antibodies

Search for all "LOC440332"

Kurzübersicht

Mouse anti Human LOC440332

H00440332-A01

Produktbeschreibung für LOC440332

Mouse anti Human LOC440332.
Presentation: Serum
Product is tested for Western blot / Immunoblot.

Produktdaten von LOC440332

Produkt-Kategorie Primärantikörper
Menge 50 µl
Präsentation Serum
Reaktivität Hu
Anwendungen WB
Klonalität Polyclonal
Wirt Mouse
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Immunogen:
LOC440332 (XP_496112, 253 a.a. ~ 349 a.a) partial recombinant protein with GST tag.
AA Sequence:
PPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTP PKLTAYLPAMSEDDEDCYGN*
Remarks:
Gene Accession: XM_496112
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
50 % glycerol
State:
Serum

Accessory Products

  • LinkedIn