nicht mehr verfügbar

NBP1-93588 LRCH2 Antikörper

See related secondary antibodies

Search for all "LRCH2"

Kurzübersicht

Rabbit anti Human LRCH2

NBP1-93588

Mehr Bilder

  • NBP1-93588

Produktbeschreibung für LRCH2

Rabbit anti Human LRCH2.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Produktdaten von LRCH2

Produkt-Kategorie Primärantikörper
Menge 0.1 ml
Präsentation Aff - Purified
Reaktivität Hu
Anwendungen P, WB
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Novus Biologicals Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q5VUJ6
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: GIGSDNGEKRLSTTEPSDDDTVSLHSQVSESNREQTSRNDSHIIGSKTDSQKDQEVYDFVDPNTEDVAVPEQGNAHIGSFVSFFKGKEKCSEKSRKNEELGDEKRLEKEQLLAEEEDDDLKEVTDLRKIAAQLLQQEQKNRI
GeneID:
57631
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 57631

Accessory Products

  • LinkedIn